Hymylle Hammaslääkäripalvelut
Avoimen menetelmämme mukaan tämä klinikka sai 70.6/100 pistettä läpinäkyvyydestä, maineesta, palvelun saavutettavuudesta ja digitaalisesta näkyvyydestä.
Kokonaissijoitus: #12 / 21 sijoitettua klinikkaa · Viimeksi tarkistettu: 2026-09-08
70.6/100
Sijoitukset vertailuprofiileittain
- Läpinäkyvyys ja luotettavuus (kokonaisarvio)#1270.6/100
- Ulkomaalaiset asukkaatei sijoitettu
- Hammasimplantit#1169/100
- Kiireellinen hammashoitoei sijoitettu
- Hintojen läpinäkyvyys#1281.7/100
- Palvelu englanniksiei sijoitettu
- Perheet ja lapset#764.8/100
- Nukutushammashoito (yleisanestesia tai syvä sedaatio)ei sijoitettu
Yleisanestesia ja syvä sedaatio
Kertooko klinikka tekevänsä hoitoa yleisanestesiassa tai syvässä sedaatiossa – niin sanottu nukutushammashoito, jossa potilas nukkuu eikä ole tietoinen ympäristöstään (ei tunne, näe eikä kuule toimenpidettä). Tavallinen kevyt sedaatio, jossa potilas pysyy hereillä ja reagoi, ei kelpaa tähän. Tieto on viitteellinen eikä vaikuta läpinäkyvyyspisteisiin.
- ✗ Yleisanestesia tai syvä sedaatio (nukutushammashoito) — Yleisanestesiaa tai syvää sedaatiota ei ole dokumentoitu No general anaesthesia or intravenous/twilight sedation is documented; the anxious-patient page relies on calm handling and local anaesthesia. [s2]
Yhteenveto
Itsenäinen klinikka Yliopistonkadulla Turun keskustassa; yleishammashoitoon yhdistyvät esteettinen hoito, kisko-oikomishoito, laserhammashoito sekä lääketieteelliset ja esteettiset injektiohoidot. Neljä nimeltä mainittua hammaslääkäriä ja neljä suuhygienistiä, joiden taustat on julkaistu, eritelty hinnasto ilman toimisto- tai palvelumaksua sekä iltavastaanotto kello 19:00 saakka neljänä päivänä viikossa. Sivustolla on täydellinen schema.org Dentist -merkintä ja hinnoiteltu palveluluettelo.
Vahvuudet
- Tietojen läpinäkyvyys: 18/20 pistettä.
- Hintojen läpinäkyvyys: 15/15 pistettä.
- Julkisista lähteistä ei löytynyt varoitusmerkkejä.
Heikkoudet
Yksikään kategoria ei jäänyt heikkouden rajan alle (50 % vahvistettavissa olevista pisteistä).
Pisteiden erittely
Jokainen alla oleva kohta pisteytetään julkisista lähteistä. ✓ vahvistettu: kyllä · ✗ vahvistettu: ei / ei löytynyt · ◐ osittain · ? ei vahvistettu (0 pistettä, ei kielteinen havainto).
Tietojen läpinäkyvyys
18 / 20
Ovatko klinikan perustiedot – henkilökunta, toimitilat, palvelut ja sijainti – julkisesti tarkistettavissa.
| ✓ | Toimivat verkkosivut Opened and read on 2026-09-07: real clinic content across services, prices, staff, contacts and patient guidance. [s1] | 4/4 |
| ✓ | Hammaslääkärien nimet julkaistu Three dentists and three hygienists named on the staff page as read on 2026-09-07, each with a written self-introduction giving graduation year, university and areas of work. (The research pass wrote four and four; the page today lists three of each.) [s3] | 3/3 |
| ✓ | Hammaslääkärien erikoisalat julkaistu Each dentist's graduation year and university are stated together with their areas of focus — stomatognathic physiology, aesthetic botulinum and sleep-apnoea splints for one, implant prosthetics, veneers, ceramic fillings, crowns and bridges for another. [s3] | 2/2 |
| ✓ | Aidot kuvat klinikan tiloista The lead owner photograph on the place page, read in a browser on 2026-09-08, is the practice's own waiting area — its green velvet armchairs, timber table and hand-sanitiser stand on the second floor at Yliopistonkatu 29 c. The profile is claimed and carries owner posts, so this is the clinic's own publication of its own premises and the criterion is met. [gmpb] | 2/2 |
| ✓ | Palveluluettelo julkaistu General dentistry, hygienist care, aesthetic dentistry, aligner orthodontics, medical and aesthetic injectables, oral and maxillofacial surgery, laser dentistry, anxious-patient care and occupational dental care, each with its own page. [s2] | 3/3 |
| ✓ | Selkeät yhteystiedot Phone, e-mail, street address with floor and opening hours in the header of every page; consistent with the Google place record. [s1] | 2/2 |
| ✗ | Englanninkielinen verkkosivusto The site is Finnish only; it declares no language alternates and carries no switcher. [s1] | 0/2 |
| ✓ | Osoite ja kartta julkaistu Street address with floor published site-wide and an embedded map; the site's own structured data carries the postal address and geo-coordinates. [s1] | 2/2 |
Hintojen läpinäkyvyys
15 / 15
Voiko potilas arvioida kustannukset ennen käyntiä. Julkaistut hintahaarukat riittävät; tarkkoja hintoja ei vaadita.
| ✓ | Hinnat tai hintahaarukat julkaistu Standing itemised price list for dentist and hygienist treatment with the price before and after Kela reimbursement; the clinic states it charges no service or office fee. [s4] | 3/3 |
| ✓ | Hammaskiven poiston hinta ilmoitettu Hammaskivenpoisto 105 €, long 123 €, very long variant priced separately. [s4] | 2/2 |
| ✓ | Paikkauksen hinta ilmoitettu One-surface 85.50 €, two 146 €, three 180 €. [s4] | 2/2 |
| ✓ | Kruunun hinta ilmoitettu Yhdistelmämuovikruunu 210 €; the ceramic crown and veneer are quoted at consultation, which the price list states explicitly. [s4] | 2/2 |
| ✓ | Implantin hinta ilmoitettu Implantti + kruunu from 1950 €. [s4] | 2/2 |
| ✓ | Ensikäynnin hinta ilmoitettu Hammastarkastus 69 € (39 € after Kela reimbursement). [s4] | 2/2 |
| ✓ | Röntgen- tai kuvantamishinta ilmoitettu Intraoral 35 €, bite-wing 50 €, panoramic 98 €. [s4] | 2/2 |
Maine ja arvostelut
12 / 20
Julkiset arvostelusignaalit. Googlen arvosana oikaistaan bayesilaisella priorilla (arvosana 4,0, painoarvo 25), jottei kourallisesta arvosteluista saatu 5,0 ohittaisi satojen arvostelujen arvosanaa 4,8.
| ◐ | Googlen arvosana (bayesilaisesti oikaistu) Read live on the place page in a browser on 2026-09-08. Unchanged from the automated reading of 2026-09-07. The star histogram — 19 five-star, 0 four-star, 0 three-star, 0 two-star and 2 one-star — sums to 21, matching the 21 in the place-page header exactly, and its weighted mean 4.619 reproduces the published 4.6. The place pin was also read for the coordinate question the open question raised: the Google place resolves to 60.4503372 / 22.2603694, which is exactly the coordinate the card carries and which sits on the Yliopistonkatu 29 c building the listing gives as its address. The 60.45033717 / 22.2577944 published in the site's own Dentist JSON-LD is about 140 m west of the building and is the outlier, so the card's geo needs no change. [gm1] [gmpb] | 3/6 |
| ◐ | Google-arvostelujen määrä Read live on 2026-09-08 from the place-page header, and the star histogram sums to the same figure. The card held 21 and the listing has not moved since. [gm1] [gmpb] | 1/3 |
| ✓ | Arvostelujen tuoreus Newest Google review is dated 2026-09-23 (listing read 2026-09-25). [hymylle-hammaslaakaripalvelut-turku-gbp-2026-09-25] | 3/3 |
| ✗ | Klinikka vastaa arvosteluihin None of the 10 reviews read on Google carries an owner reply, including the 10 dated 2025-08-19 to 2026-09-23. [hymylle-hammaslaakaripalvelut-turku-deepen-5] | 0/2 |
| ✓ | Ei toistuvia valituksia One critical account is visible and readable in full, a one-star a year old describing belittling and scolding treatment of a patient afraid of pain and a complete lack of understanding. It stands alone: no second negative on that or any other theme is surfaced, so the criterion is false. The one- and two-star mass is 2 of 21 = 9.5 %, and the second account is not surfaced by relevance ordering. Sample: the eight reviews Google Maps renders on the place page in its own relevance order — the "Newest" sort does not open to automation, so a review more recent than the newest one visible may exist. [gmpb] | 2/2 |
| ✓ | Ei epäilyttäviä arvostelukaavoja Judged on the histogram shape, the spread of dates, the variety of reviewers and the wording, on 2026-09-08. The distribution is strictly two-valued (19 five-star, 2 one-star, nothing between), which on a base of 21 is disclosed rather than scored: the visible dates spread from eight months to two years, the accounts describe different treatments and different clinicians, and the owner engages with none of them at all — including the one-star, which a curated record would have answered. [gmpb] | 2/2 |
| ✓ | Aktiivinen Facebook-sivu The clinic links its own Facebook page from its site, alongside Instagram. [fb1] | 1/1 |
| ✗ | Näkyvyys TripAdvisorissa No TripAdvisor listing found via its search for "Hymylle Hammaslääkäripalvelut Turku" and "Hymylle Hammaslääkäripalvelut"; the clinic's site does not link to TripAdvisor (checked 2026-10-05). [hymylle-hammaslaakaripalvelut-turku-tripadvisor] [hymylle-hammaslaakaripalvelut-turku-tripadvisor-2] | 0/0.5 |
| ✗ | Muut arvostelualustat No profile on WhatClinic or Trustpilot, and Dental Departures and Bookimed list no Finnish clinics; no Yelp page was found under its name, nor a Finnish dentist-review site with reviews of its own. [hymylle-hammaslaakaripalvelut-turku-deepen] [hymylle-hammaslaakaripalvelut-turku-deepen-2] [hymylle-hammaslaakaripalvelut-turku-deepen-3] [hymylle-hammaslaakaripalvelut-turku-deepen-4] | 0/0.5 |
Lääketieteellinen välineistö
9.5 / 15
Julkisesti dokumentoitujen laitteiden ja palvelujen laajuus. Tämä mittaa dokumentoitua saatavuutta, ei hoidon laatua.
| ✓ | Röntgen omissa tiloissa Intraoral, bite-wing and panoramic imaging priced in the clinic's own price list. [s4] | 2/2 |
| ✗ | CBCT eli 3D-kuvantaminen The price list covers intraoral, bite-wing and panoramic imaging only; no cone-beam CT is priced or described. [s4] | 0/2 |
| ✓ | Implantologia Implant prosthetics named among a dentist's areas of work, and implant treatment priced. [s3] [s4] | 2/2 |
| ✓ | Oikomishoito Invisalign aligner orthodontics with its own page and a published starting price of 2200 €. [s2] [s4] | 2/2 |
| ✓ | Suukirurgia Dedicated oral and maxillofacial surgery page covering implants, soft-tissue operations and other minor oral surgery. [s5] | 2/2 |
| ✓ | Lasten hammashoito A dentist profile states that she treats patients of all ages ('Hoidan kaikenikäisiä potilaita'). [s3] | 1.5/1.5 |
| ✗ | Kiireellinen hoito ja päivystys No emergency or same-day service is named among the services; the clinic offers a dental-fear route but not an emergency one. [s2] | 0/1.5 |
| ✗ | Hoitaa kansainvälisiä potilaita The clinic publishes nothing about foreign patients and keeps no non-Finnish version of its site. [s1] | 0/2 |
Viestintä ja palvelu
4 / 10
Kuinka helppoa klinikkaan on saada yhteys, saada vastauksia ja varata aika – erityisesti kansainvälisen potilaan näkökulmasta.
| ✗ | WhatsApp tai LINE käytössä Phone, e-mail and online booking only. [s1] | 0/2 |
| ? | Vastausnopeus | 0/1.5 |
| ? | Palvelua englanniksi The clinic makes no statement about the languages it works in, and there is no non-Finnish version to infer from. | 0/2.5 |
| ✓ | Ennakkokonsultaatio mahdollinen The site offers a free treatment estimate ('Pyydä maksuton hoitoarvio') as a standing call to action. [s1] | 1.5/1.5 |
| ✓ | Selkeät palvelukuvaukset Each service page explains the treatment in plain Finnish, with a background section on what it involves. [s5] | 1/1 |
| ✓ | Sopivat aukioloajat Confirmed on the clinic's own Google Business Profile, read in a browser on 2026-09-08: Monday to Thursday 08:00–19:00, Friday 08:00–17:00, Saturday and Sunday closed. The 19:00 close on four weekdays matches the clinic's own site exactly. [s1] [gmpb] | 1.5/1.5 |
Näkyvyys tekoälyssä ja haussa
5 / 10
Löytyykö klinikka, kun potilaat hakevat tietoa – myös tekoälyavustajien kautta. Tarkistetaan kiinteillä hauilla: "best dentist Finland", "English speaking dentist Finland", "dental implants Finland", "emergency dentist Finland", "Finland dental clinic for expats".
| ✗ | Mainittu haulla: best dentist Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq1] | 0/1 |
| ✗ | Mainittu haulla: English speaking dentist Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq2] | 0/1 |
| ✗ | Mainittu haulla: dental implants Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq3] | 0/1 |
| ✗ | Mainittu haulla: emergency dentist Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq4] | 0/1 |
| ? | Mainittu haulla: Finland dental clinic for expats The fifth canonical query was not run for this city in the AI-visibility pass: the pass ran it only for the first research city of each country (Helsinki for Finland). Left unset rather than guessed. | 0/1 |
| ✓ | Rakenteinen data verkkosivuilla The site carries a full schema.org Dentist entity with PostalAddress, GeoCoordinates, opening hours and an OfferCatalog of priced MedicalProcedure offers — the strongest markup of the four Turku clinics researched. [s1] | 1.5/1.5 |
| ✓ | Googlen indeksoinnin laatu The clinic's own domain holds the first result for its own name and five of the first thirteen (front page, services, contacts, price list, staff); the rest are its Facebook page, directories and a LinkedIn profile of its chief dentist. [giq1] | 2/2 |
| ✓ | Omat sivut palveluille Individual pages per treatment across nine service groups. [s2] | 1.5/1.5 |
Vertailun kärkiklinikat tekoälyn vastauksissa
Yllä olevat haut ovat tämän vertailun oma tarkistus. Kolmesta kärkiklinikasta on lisäksi kattava mittaus: kuinka usein ChatGPT ja Gemini mainitsevat ne, kun potilas pyytää suositusta hammaslääkäristä.
- #1Hammaslääkäriasema Dent Å14.9 / 100Katso raportti → englanninkielinen raportti
- #2Hammasvahti47.6 / 100Katso raportti → englanninkielinen raportti
- #3Hammaslääkäriasema Helmiäinen52.3 / 100Katso raportti → englanninkielinen raportti
Mittaus: Ansmeter, 2026-10-08. Ansmeter on meihin sidoksissa oleva palvelu. Sen luku ei ole osa tätä vertailua eikä vaikuta sijoituksiin – pistemäärä muuttuu vain, kun julkinen data muuttuu.
Luvat ja pätevyydet
Julkaiseeko klinikka toimilupansa sekä siellä työskentelevät hammaslääkärit ja heidän ammattirekisterinumeronsa. Vahvistettu ”ei julkaistu” kirjataan varoitusmerkiksi; vielä tarkistamattomat tiedot näkyvät vahvistamattomina eivätkä aiheuta vähennystä.
Klinikan toimilupa: ei vielä tarkistettu julkisista lähteistä – ei vahvistettu, ei vähennystä
Hammaslääkärit ja ammattirekisterinumerot
| Hammaslääkäri | Erikoisala | Rekisterinumero |
|---|---|---|
| Emma Ylitalo [s3] | Hammaslääkäri, chief dentist; graduated University of Turku 2010, seven years in the public sector before private practice | ei vahvistettu |
| Saija Vahe [s3] | Hammaslääkäri; graduated University of Turku 1998; implant prosthetics, veneers, ceramic fillings, crowns, bridges and removable prosthetics | ei vahvistettu |
| Anna Wickström [s3] | Hammaslääkäri; graduated University of Eastern Finland 2023; general dentistry, public and private sector experience | ei vahvistettu |
Hammaslääkärit on nimetty; heidän rekisterinumeroitaan ei ole vielä tarkistettu julkisista lähteistä – ei vahvistettu, ei vähennystä.
Varoitusmerkit
Tarkistamistamme julkisista lähteistä ei löytynyt varoitusmerkkejä.
Tiedot, joita emme voineet vahvistaa
- Viestintä ja palvelu: Vastausnopeus
- Viestintä ja palvelu: Palvelua englanniksi
- Näkyvyys tekoälyssä ja haussa: Mainittu haulla: Finland dental clinic for expats
Vahvistamattomat kohdat saavat 0 pistettä, mutta niitä ei käsitellä kielteisinä havaintoina. Jos voit dokumentoida jonkin niistä, lähetä korjaus.
Yhteystiedot
| Verkkosivut | https://hymylle.fi/ |
|---|---|
| Puhelin | +358 10 212 1680 |
| https://www.facebook.com/hymylle/ | |
| Google Maps | Karttamerkintä |
| Osoite | Yliopistonkatu 29 c B, 2nd floor, 20100 Turku, Finland |
Yhteystiedot on annettu vain tunnistamista varten ja ne voivat muuttua; varmista tiedot suoraan klinikalta.
Lähteet
| Tunnus | Lähde | Mitä se tukee | Haettu |
|---|---|---|---|
| s1 | https://hymylle.fi/ | Clinic's own front page: hours, address, contacts, free treatment estimate | 2026-09-07 |
| s2 | https://hymylle.fi/palvelut-turku | Clinic's own service index | 2026-09-07 |
| s3 | https://hymylle.fi/henkilokunta | Own site roster page names this dentist (read 2026-09-10): "tiikka, laminaatit, keraamiset täytteet, kruunut, sillat ja irtoproteesit) Anna Wickström Hammaslääkäri Olen valmistunut hammaslääkäriksi Itä-Suomen yliopistosta vuonna" | 2026-09-10 |
| s4 | https://hymylle.fi/hinnasto | Clinic's own standing price list | 2026-09-07 |
| s5 | https://hymylle.fi/hammaskirurgia-turku | Clinic's own oral and maxillofacial surgery page | 2026-09-07 |
| gm1 | https://www.google.com/maps/place/?q=place_id:ChIJESAMUHJ3jEYRCZi-A… | Live Google Maps place record: name, category Dentist, address, website, rating, coordinates | 2026-09-07 |
| fb1 | https://www.facebook.com/hymylle/ | Clinic's own Facebook page, linked from its site | 2026-09-07 |
| giq1 | search:"Hymylle Hammaslääkäripalvelut" Turku | Name-and-city search used to judge how well the clinic's own pages rank for its own name (web search) | 2026-09-07 |
| bsq1 | search:best dentist Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| bsq2 | search:English speaking dentist Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| bsq3 | search:dental implants Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| bsq4 | search:emergency dentist Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| gmpb | https://www.google.com/maps/place/x/@60.4503372,22.2603694,17z/data… | The clinic’s Google Maps place page, opened in a real browser on 2026-09-08. The Reviews tab (this URL) gives the headline rating, the review-count header, the five star-histogram buckets read whole from their accessibility labels, and the eight most-relevant reviews with their star values, dates, text and owner replies; the sibling Overview URL https://www.google.com/maps/place/x/@60.4503372,22.2603694,17z/data=!4m5!3m4!1s0x468c7772500c2011:0x3c85adca03be9809!8m2!3d60.4503372!4d22.2603694?hl=en gives the listing name, address, telephone, website, business category, the full published opening week and the lead owner photograph. The listing opens as «Hymylle Hammaslääkäripalvelut Oy», category Dentist, at Yliopistonkatu 29 c B23-24, 2. kerros, 20100 Turku · +358 10 212 1680 · hymylle.fi — the identifiers the card itself carries, so the place identifier resolves to this practice and not to a neighbour. | 2026-09-08 |
| hymylle-hammaslaakaripalvelut-turku-gbp-2026-09-25 | https://www.google.com/maps?cid=4361082897336014857&hl=en | Google listing read on 2026-09-25: rating 4.6 from 22 reviews; star histogram 1★ 2 / 2★ 0 / 3★ 0 / 4★ 1 / 5★ 19; newest review dated 2026-09-23. | 2026-09-25 |
| hymylle-hammaslaakaripalvelut-turku-deepen | https://www.whatclinic.com/dentists/finland | WhatClinic read 2026-10-02: the Turku catalogue (no Turku page; none listed) and WhatClinic's Finland sitemap (8 Finnish profiles) list no profile for the clinic; direct addresses /dentists/finland/hymylle-hammaslaeaekaeripalvelut, /dentists/finland/hymylle return 404. | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-2 | https://www.trustpilot.com/review/hymylle.fi | Trustpilot read 2026-10-02: no page for hymylle.fi ("Whoops! The page you're looking for could not be found"). | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-3 | https://www.dentaldepartures.com/dentists/finland | Dental Departures read 2026-10-02: has no Finland location (its Finland page returns "not found" and its clinic search recognises neither Finland nor Turku); no profile for this clinic. | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-4 | https://us-uk.bookimed.com/sitemap-us-uk-clinics-country.xml | Bookimed read 2026-10-02: Finland is not among its 53 clinic countries (no Finland page), and none of its 2,127 clinic pages is in Finland. | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-5 | https://www.google.com/maps?cid=4361082897336014857&hl=en | Google listing "Hymylle Hammaslääkäripalvelut Oy" (Dentist), read 2026-10-02 in three review orders (newest, lowest-rated, most relevant first): 4.6 from 22 reviews (1★ 2 / 2★ 0 / 3★ 0 / 4★ 1 / 5★ 19); 10 distinct reviews read, dated 2025-08-19 to 2026-09-23 | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-tripadvisor | https://www.tripadvisor.com/TypeAheadJson?action=API&details=true&q… | TripAdvisor's own search, read 2026-10-05: 12 suggestions for "Hymylle Hammaslääkäripalvelut Turku" (1 place, 4 attractions, 6 hotels, 1 restaurant), none of them a dental practice in or near Turku; no suggestions for "Hymylle Hammaslääkäripalvelut"; no listing for this clinic | 2026-10-05 |
| hymylle-hammaslaakaripalvelut-turku-tripadvisor-2 | https://hymylle.fi/ | Clinic's website, home page read 2026-10-05: no link to a TripAdvisor page | 2026-10-05 |
Muutoshistoria
| Päivämäärä | Muutos |
|---|---|
| 2026-10-05 | TripAdvisor presence checked on 2026-10-05: no listing found for this clinic. |
| 2026-10-02 | Read 10 of the clinic's Google reviews on 2026-10-02: no owner replies seen. |
| 2026-10-02 | Presence on review platforms checked on 2026-10-02: no profile on WhatClinic or Trustpilot; Dental Departures and Bookimed do not cover Finland. |
| 2026-09-29 | Corrected 2026-09-29: clinic responds to reviews now unverified: only 8 reviews were checked for owner replies; review recency within 3 months (newest review dated 2026-09-23). |
| 2026-09-10 | Name-verification pass 2026-09-10: 2 doctor(s) previously no-match against the own-site roster confirmed by re-reading the clinic's staff/team page(s) (Saija Vahe; Anna Wickström); no data other than sources/license-passthrough changed. |
| 2026-09-08 | Checked by hand in a browser: the clinic’s Google Maps place page was opened in a real browser and read on both its Reviews and Overview tabs. Recorded from it: the rating re-verified against the star histogram, the review count, the histogram itself (19/0/0/0/2 = 21, weighted mean 4.619), review recency, the owner-reply state, the complaint reading and the manipulation reading from the eight most-relevant reviews, the lead owner photograph and the full published opening week. Fields this pass did not measure are untouched. |
| 2026-09-07 | Initial data collection: clinic website read across the front page, service index, staff page, price list, surgery page and service-voucher page; Google Maps place record read live. Review-side fields and both licence layers left unset with reasons and queued for a manual browser check. |
Kysymys tai korjaus?
Onko sinulla kysymys, ehdotus tai korjaus tähän sivuun? Ota yhteyttä – luemme jokaisen viestin. Datakorjaukset tarkistetaan lähteitä vasten, ja tehdyt korjaukset kirjataan julkiseen muutoshistoriaan.
Ota yhteyttä aiheesta Hymylle Hammaslääkäripalvelut Lähetä sähköpostia