Hymylle Hammaslääkäripalvelut
According to our open methodology, this clinic scored 70.6/100 for transparency, reputation, service accessibility, and digital visibility.
Overall rank: #12 of 21 ranked clinics · Last checked: 8 September 2026
70.6/100
Positions by Rating Profile
- Overall Transparency & Trust#1270.6/100
- Best for Expatsnot ranked
- Best for Dental Implants#1169/100
- Best for Emergency Dental Carenot ranked
- Best Price Transparency#1281.7/100
- Best English-speaking Clinicsnot ranked
- Best for Families / Children#764.8/100
- Sleep Dentistry (GA / deep sedation)not ranked
General Anaesthesia & Deep Sedation
Whether the clinic documents treatment under general anaesthesia or deep / twilight sedation — "sleep dentistry", where the patient is asleep and unaware (does not feel, see, or hear the procedure). Ordinary conscious sedation, where the patient stays awake and responsive, does not count here. This is informational and does not affect the transparency score.
- ✗ General anaesthesia / deep sedation (sleep dentistry) — No general anaesthesia or deep sedation documented No general anaesthesia or intravenous/twilight sedation is documented; the anxious-patient page relies on calm handling and local anaesthesia. [s2]
Summary
Independent clinic on Yliopistonkatu in central Turku combining general dentistry with aesthetic work, aligner orthodontics, laser dentistry and medical and aesthetic injectables. Four named dentists and four hygienists with published backgrounds, an itemised price list with no office or service fee, and evening appointments to 19:00 on four days a week. The site carries full schema.org Dentist markup with a priced service catalogue.
Strengths
- Information Transparency: 18 of 20 points.
- Price Transparency: 15 of 15 points.
- No red flags identified in public sources.
Weaknesses
No category fell below the weakness threshold (50% of verifiable points).
Score Breakdown
Every criterion below is scored from public sources. ✓ verified yes · ✗ verified no / not found · ◐ partial · ? unverified (scores 0, not a negative finding).
Information Transparency
18 / 20
Whether basic facts about the clinic - its team, premises, services, and location - are publicly verifiable.
| ✓ | Has a working website Opened and read on 2026-09-07: real clinic content across services, prices, staff, contacts and patient guidance. [s1] | 4/4 |
| ✓ | Dentist names listed Three dentists and three hygienists named on the staff page as read on 2026-09-07, each with a written self-introduction giving graduation year, university and areas of work. (The research pass wrote four and four; the page today lists three of each.) [s3] | 3/3 |
| ✓ | Dentist specializations listed Each dentist's graduation year and university are stated together with their areas of focus — stomatognathic physiology, aesthetic botulinum and sleep-apnoea splints for one, implant prosthetics, veneers, ceramic fillings, crowns and bridges for another. [s3] | 2/2 |
| ✓ | Real clinic photos The lead owner photograph on the place page, read in a browser on 2026-09-08, is the practice's own waiting area — its green velvet armchairs, timber table and hand-sanitiser stand on the second floor at Yliopistonkatu 29 c. The profile is claimed and carries owner posts, so this is the clinic's own publication of its own premises and the criterion is met. [gmpb] | 2/2 |
| ✓ | Service list published General dentistry, hygienist care, aesthetic dentistry, aligner orthodontics, medical and aesthetic injectables, oral and maxillofacial surgery, laser dentistry, anxious-patient care and occupational dental care, each with its own page. [s2] | 3/3 |
| ✓ | Clear contact details Phone, e-mail, street address with floor and opening hours in the header of every page; consistent with the Google place record. [s1] | 2/2 |
| ✗ | English website version The site is Finnish only; it declares no language alternates and carries no switcher. [s1] | 0/2 |
| ✓ | Address and map published Street address with floor published site-wide and an embedded map; the site's own structured data carries the postal address and geo-coordinates. [s1] | 2/2 |
Price Transparency
15 / 15
Whether patients can estimate costs before visiting. Published price ranges count; exact prices are not required.
| ✓ | Prices or price ranges published Standing itemised price list for dentist and hygienist treatment with the price before and after Kela reimbursement; the clinic states it charges no service or office fee. [s4] | 3/3 |
| ✓ | Cleaning price listed Hammaskivenpoisto 105 €, long 123 €, very long variant priced separately. [s4] | 2/2 |
| ✓ | Filling price listed One-surface 85.50 €, two 146 €, three 180 €. [s4] | 2/2 |
| ✓ | Crown price listed Yhdistelmämuovikruunu 210 €; the ceramic crown and veneer are quoted at consultation, which the price list states explicitly. [s4] | 2/2 |
| ✓ | Implant price listed Implantti + kruunu from 1950 €. [s4] | 2/2 |
| ✓ | Consultation price listed Hammastarkastus 69 € (39 € after Kela reimbursement). [s4] | 2/2 |
| ✓ | X-ray / imaging price listed Intraoral 35 €, bite-wing 50 €, panoramic 98 €. [s4] | 2/2 |
Reputation & Reviews
12 / 20
Public review signals. The Google rating is adjusted with a Bayesian prior (rating 4.0, weight 25) so a 5.0 from a handful of reviews does not outrank a 4.8 from hundreds.
| ◐ | Google rating (Bayesian-adjusted) Read live on the place page in a browser on 2026-09-08. Unchanged from the automated reading of 2026-09-07. The star histogram — 19 five-star, 0 four-star, 0 three-star, 0 two-star and 2 one-star — sums to 21, matching the 21 in the place-page header exactly, and its weighted mean 4.619 reproduces the published 4.6. The place pin was also read for the coordinate question the open question raised: the Google place resolves to 60.4503372 / 22.2603694, which is exactly the coordinate the card carries and which sits on the Yliopistonkatu 29 c building the listing gives as its address. The 60.45033717 / 22.2577944 published in the site's own Dentist JSON-LD is about 140 m west of the building and is the outlier, so the card's geo needs no change. [gm1] [gmpb] | 3/6 |
| ◐ | Google review volume Read live on 2026-09-08 from the place-page header, and the star histogram sums to the same figure. The card held 21 and the listing has not moved since. [gm1] [gmpb] | 1/3 |
| ✓ | Review recency Newest Google review is dated 2026-09-23 (listing read 2026-09-25). [hymylle-hammaslaakaripalvelut-turku-gbp-2026-09-25] | 3/3 |
| ✗ | Clinic responds to reviews None of the 10 reviews read on Google carries an owner reply, including the 10 dated 2025-08-19 to 2026-09-23. [hymylle-hammaslaakaripalvelut-turku-deepen-5] | 0/2 |
| ✓ | No recurring complaints One critical account is visible and readable in full, a one-star a year old describing belittling and scolding treatment of a patient afraid of pain and a complete lack of understanding. It stands alone: no second negative on that or any other theme is surfaced, so the criterion is false. The one- and two-star mass is 2 of 21 = 9.5 %, and the second account is not surfaced by relevance ordering. Sample: the eight reviews Google Maps renders on the place page in its own relevance order — the "Newest" sort does not open to automation, so a review more recent than the newest one visible may exist. [gmpb] | 2/2 |
| ✓ | No suspicious review patterns Judged on the histogram shape, the spread of dates, the variety of reviewers and the wording, on 2026-09-08. The distribution is strictly two-valued (19 five-star, 2 one-star, nothing between), which on a base of 21 is disclosed rather than scored: the visible dates spread from eight months to two years, the accounts describe different treatments and different clinicians, and the owner engages with none of them at all — including the one-star, which a curated record would have answered. [gmpb] | 2/2 |
| ✓ | Active Facebook presence The clinic links its own Facebook page from its site, alongside Instagram. [fb1] | 1/1 |
| ✗ | TripAdvisor presence No TripAdvisor listing found via its search for "Hymylle Hammaslääkäripalvelut Turku" and "Hymylle Hammaslääkäripalvelut"; the clinic's site does not link to TripAdvisor (checked 2026-10-05). [hymylle-hammaslaakaripalvelut-turku-tripadvisor] [hymylle-hammaslaakaripalvelut-turku-tripadvisor-2] | 0/0.5 |
| ✗ | Other review platforms No profile on WhatClinic or Trustpilot, and Dental Departures and Bookimed list no Finnish clinics; no Yelp page was found under its name, nor a Finnish dentist-review site with reviews of its own. [hymylle-hammaslaakaripalvelut-turku-deepen] [hymylle-hammaslaakaripalvelut-turku-deepen-2] [hymylle-hammaslaakaripalvelut-turku-deepen-3] [hymylle-hammaslaakaripalvelut-turku-deepen-4] | 0/0.5 |
Medical Infrastructure
9.5 / 15
The range of publicly documented equipment and services. This measures documented availability, not clinical quality.
| ✓ | On-site X-ray Intraoral, bite-wing and panoramic imaging priced in the clinic's own price list. [s4] | 2/2 |
| ✗ | CBCT (3D imaging) The price list covers intraoral, bite-wing and panoramic imaging only; no cone-beam CT is priced or described. [s4] | 0/2 |
| ✓ | Implantology Implant prosthetics named among a dentist's areas of work, and implant treatment priced. [s3] [s4] | 2/2 |
| ✓ | Orthodontics Invisalign aligner orthodontics with its own page and a published starting price of 2200 €. [s2] [s4] | 2/2 |
| ✓ | Oral surgery Dedicated oral and maxillofacial surgery page covering implants, soft-tissue operations and other minor oral surgery. [s5] | 2/2 |
| ✓ | Pediatric dentistry A dentist profile states that she treats patients of all ages ('Hoidan kaikenikäisiä potilaita'). [s3] | 1.5/1.5 |
| ✗ | Emergency care No emergency or same-day service is named among the services; the clinic offers a dental-fear route but not an emergency one. [s2] | 0/1.5 |
| ✗ | Works with international patients The clinic publishes nothing about foreign patients and keeps no non-Finnish version of its site. [s1] | 0/2 |
Communication & Service
4 / 10
How easy it is to contact the clinic, get answers, and book - especially for international patients.
| ✗ | WhatsApp / LINE available Phone, e-mail and online booking only. [s1] | 0/2 |
| ? | Response speed | 0/1.5 |
| ? | English spoken The clinic makes no statement about the languages it works in, and there is no non-Finnish version to infer from. | 0/2.5 |
| ✓ | Pre-visit consultation possible The site offers a free treatment estimate ('Pyydä maksuton hoitoarvio') as a standing call to action. [s1] | 1.5/1.5 |
| ✓ | Clear service explanations Each service page explains the treatment in plain Finnish, with a background section on what it involves. [s5] | 1/1 |
| ✓ | Convenient opening hours Confirmed on the clinic's own Google Business Profile, read in a browser on 2026-09-08: Monday to Thursday 08:00–19:00, Friday 08:00–17:00, Saturday and Sunday closed. The 19:00 close on four weekdays matches the clinic's own site exactly. [s1] [gmpb] | 1.5/1.5 |
AI & Search Visibility
5 / 10
Whether the clinic is discoverable when patients search - including via AI assistants. Checked with fixed queries: "best dentist Finland", "English speaking dentist Finland", "dental implants Finland", "emergency dentist Finland", "Finland dental clinic for expats".
| ✗ | Mentioned for: best dentist Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq1] | 0/1 |
| ✗ | Mentioned for: English speaking dentist Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq2] | 0/1 |
| ✗ | Mentioned for: dental implants Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq3] | 0/1 |
| ✗ | Mentioned for: emergency dentist Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq4] | 0/1 |
| ? | Mentioned for: Finland dental clinic for expats The fifth canonical query was not run for this city in the AI-visibility pass: the pass ran it only for the first research city of each country (Helsinki for Finland). Left unset rather than guessed. | 0/1 |
| ✓ | Structured data on website The site carries a full schema.org Dentist entity with PostalAddress, GeoCoordinates, opening hours and an OfferCatalog of priced MedicalProcedure offers — the strongest markup of the four Turku clinics researched. [s1] | 1.5/1.5 |
| ✓ | Google indexing quality The clinic's own domain holds the first result for its own name and five of the first thirteen (front page, services, contacts, price list, staff); the rest are its Facebook page, directories and a LinkedIn profile of its chief dentist. [giq1] | 2/2 |
| ✓ | Dedicated service pages Individual pages per treatment across nine service groups. [s2] | 1.5/1.5 |
Ranking leaders in AI answers
The queries above are this index's own check. The three leading clinics have also been measured in full: how often ChatGPT and Gemini name them when a patient asks them to recommend a dentist.
- #1Hammaslääkäriasema Dent Å14.9 of 100View report →
- #2Hammasvahti47.6 of 100View report →
- #3Hammaslääkäriasema Helmiäinen52.3 of 100View report →
Measured by Ansmeter, 8 October 2026. Ansmeter is an affiliated service. Its figure is not part of this rating and does not affect positions — scores change only when public data changes.
Licensing & Credentials
Whether the clinic publishes its operating licence and the dentists working there together with their professional licence numbers. A verified “not published” is recorded as a red flag; data we have not checked yet is shown as unverified and carries no penalty.
Clinic operating licence: not checked against public sources yet — unverified, no penalty
Dentists & professional licences
| Dentist | Specialization | Licence No. |
|---|---|---|
| Emma Ylitalo [s3] | Hammaslääkäri, chief dentist; graduated University of Turku 2010, seven years in the public sector before private practice | not verified |
| Saija Vahe [s3] | Hammaslääkäri; graduated University of Turku 1998; implant prosthetics, veneers, ceramic fillings, crowns, bridges and removable prosthetics | not verified |
| Anna Wickström [s3] | Hammaslääkäri; graduated University of Eastern Finland 2023; general dentistry, public and private sector experience | not verified |
Dentists are named; their licence numbers have not been checked against public sources yet — unverified, no penalty.
Red Flags
No red flags identified in the public sources we reviewed.
Data We Could Not Verify
- Communication & Service: Response speed
- Communication & Service: English spoken
- AI & Search Visibility: Mentioned for: Finland dental clinic for expats
Unverified items score 0 points but are not treated as negative findings. If you can document any of them, please send a correction.
Contact Information
| Website | https://hymylle.fi/ |
|---|---|
| Phone | +358 10 212 1680 |
| https://www.facebook.com/hymylle/ | |
| Google Maps | Map listing |
| Address | Yliopistonkatu 29 c B, 2nd floor, 20100 Turku, Finland |
Contact details are provided for identification only and may change; verify with the clinic directly.
Sources
| ID | Source | What it supports | Accessed |
|---|---|---|---|
| s1 | https://hymylle.fi/ | Clinic's own front page: hours, address, contacts, free treatment estimate | 2026-09-07 |
| s2 | https://hymylle.fi/palvelut-turku | Clinic's own service index | 2026-09-07 |
| s3 | https://hymylle.fi/henkilokunta | Own site roster page names this dentist (read 2026-09-10): "tiikka, laminaatit, keraamiset täytteet, kruunut, sillat ja irtoproteesit) Anna Wickström Hammaslääkäri Olen valmistunut hammaslääkäriksi Itä-Suomen yliopistosta vuonna" | 2026-09-10 |
| s4 | https://hymylle.fi/hinnasto | Clinic's own standing price list | 2026-09-07 |
| s5 | https://hymylle.fi/hammaskirurgia-turku | Clinic's own oral and maxillofacial surgery page | 2026-09-07 |
| gm1 | https://www.google.com/maps/place/?q=place_id:ChIJESAMUHJ3jEYRCZi-A… | Live Google Maps place record: name, category Dentist, address, website, rating, coordinates | 2026-09-07 |
| fb1 | https://www.facebook.com/hymylle/ | Clinic's own Facebook page, linked from its site | 2026-09-07 |
| giq1 | search:"Hymylle Hammaslääkäripalvelut" Turku | Name-and-city search used to judge how well the clinic's own pages rank for its own name (web search) | 2026-09-07 |
| bsq1 | search:best dentist Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| bsq2 | search:English speaking dentist Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| bsq3 | search:dental implants Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| bsq4 | search:emergency dentist Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| gmpb | https://www.google.com/maps/place/x/@60.4503372,22.2603694,17z/data… | The clinic’s Google Maps place page, opened in a real browser on 2026-09-08. The Reviews tab (this URL) gives the headline rating, the review-count header, the five star-histogram buckets read whole from their accessibility labels, and the eight most-relevant reviews with their star values, dates, text and owner replies; the sibling Overview URL https://www.google.com/maps/place/x/@60.4503372,22.2603694,17z/data=!4m5!3m4!1s0x468c7772500c2011:0x3c85adca03be9809!8m2!3d60.4503372!4d22.2603694?hl=en gives the listing name, address, telephone, website, business category, the full published opening week and the lead owner photograph. The listing opens as «Hymylle Hammaslääkäripalvelut Oy», category Dentist, at Yliopistonkatu 29 c B23-24, 2. kerros, 20100 Turku · +358 10 212 1680 · hymylle.fi — the identifiers the card itself carries, so the place identifier resolves to this practice and not to a neighbour. | 2026-09-08 |
| hymylle-hammaslaakaripalvelut-turku-gbp-2026-09-25 | https://www.google.com/maps?cid=4361082897336014857&hl=en | Google listing read on 2026-09-25: rating 4.6 from 22 reviews; star histogram 1★ 2 / 2★ 0 / 3★ 0 / 4★ 1 / 5★ 19; newest review dated 2026-09-23. | 2026-09-25 |
| hymylle-hammaslaakaripalvelut-turku-deepen | https://www.whatclinic.com/dentists/finland | WhatClinic read 2026-10-02: the Turku catalogue (no Turku page; none listed) and WhatClinic's Finland sitemap (8 Finnish profiles) list no profile for the clinic; direct addresses /dentists/finland/hymylle-hammaslaeaekaeripalvelut, /dentists/finland/hymylle return 404. | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-2 | https://www.trustpilot.com/review/hymylle.fi | Trustpilot read 2026-10-02: no page for hymylle.fi ("Whoops! The page you're looking for could not be found"). | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-3 | https://www.dentaldepartures.com/dentists/finland | Dental Departures read 2026-10-02: has no Finland location (its Finland page returns "not found" and its clinic search recognises neither Finland nor Turku); no profile for this clinic. | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-4 | https://us-uk.bookimed.com/sitemap-us-uk-clinics-country.xml | Bookimed read 2026-10-02: Finland is not among its 53 clinic countries (no Finland page), and none of its 2,127 clinic pages is in Finland. | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-5 | https://www.google.com/maps?cid=4361082897336014857&hl=en | Google listing "Hymylle Hammaslääkäripalvelut Oy" (Dentist), read 2026-10-02 in three review orders (newest, lowest-rated, most relevant first): 4.6 from 22 reviews (1★ 2 / 2★ 0 / 3★ 0 / 4★ 1 / 5★ 19); 10 distinct reviews read, dated 2025-08-19 to 2026-09-23 | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-tripadvisor | https://www.tripadvisor.com/TypeAheadJson?action=API&details=true&q… | TripAdvisor's own search, read 2026-10-05: 12 suggestions for "Hymylle Hammaslääkäripalvelut Turku" (1 place, 4 attractions, 6 hotels, 1 restaurant), none of them a dental practice in or near Turku; no suggestions for "Hymylle Hammaslääkäripalvelut"; no listing for this clinic | 2026-10-05 |
| hymylle-hammaslaakaripalvelut-turku-tripadvisor-2 | https://hymylle.fi/ | Clinic's website, home page read 2026-10-05: no link to a TripAdvisor page | 2026-10-05 |
Change History
| Date | Change |
|---|---|
| 2026-10-05 | TripAdvisor presence checked on 2026-10-05: no listing found for this clinic. |
| 2026-10-02 | Read 10 of the clinic's Google reviews on 2026-10-02: no owner replies seen. |
| 2026-10-02 | Presence on review platforms checked on 2026-10-02: no profile on WhatClinic or Trustpilot; Dental Departures and Bookimed do not cover Finland. |
| 2026-09-29 | Corrected 2026-09-29: clinic responds to reviews now unverified: only 8 reviews were checked for owner replies; review recency within 3 months (newest review dated 2026-09-23). |
| 2026-09-10 | Name-verification pass 2026-09-10: 2 doctor(s) previously no-match against the own-site roster confirmed by re-reading the clinic's staff/team page(s) (Saija Vahe; Anna Wickström); no data other than sources/license-passthrough changed. |
| 2026-09-08 | Checked by hand in a browser: the clinic’s Google Maps place page was opened in a real browser and read on both its Reviews and Overview tabs. Recorded from it: the rating re-verified against the star histogram, the review count, the histogram itself (19/0/0/0/2 = 21, weighted mean 4.619), review recency, the owner-reply state, the complaint reading and the manipulation reading from the eight most-relevant reviews, the lead owner photograph and the full published opening week. Fields this pass did not measure are untouched. |
| 2026-09-07 | Initial data collection: clinic website read across the front page, service index, staff page, price list, surgery page and service-voucher page; Google Maps place record read live. Review-side fields and both licence layers left unset with reasons and queued for a manual browser check. |
A question or a correction?
Have a question, a suggestion, or a correction to this page? Get in touch — we read every message. Verified data corrections are reviewed against sources and applied with a public change-history entry.