Hymylle Hammaslääkäripalvelut
Enligt vår öppna metodik fick den här mottagningen 70.6/100 poäng för öppenhet, rykte, tillgänglighet och digital synlighet.
Total placering: #12 av 21 rankade mottagningar · Senast kontrollerad: 2026-09-08
70.6/100
Placeringar per rankningsprofil
- Öppenhet och förtroende totalt#1270.6/100
- Bäst för internationella invånarerankas inte
- Bäst för tandimplantat#1169/100
- Bäst för akuttandvårdrankas inte
- Bäst öppenhet om priser#1281.7/100
- Bäst engelskspråkiga mottagningarrankas inte
- Bäst för familjer och barn#764.8/100
- Sövd tandvård (narkos eller djup sedering)rankas inte
Narkos och djup sedering
Om mottagningen dokumenterar behandling under narkos eller djup sedering – så kallad sövd tandvård, där du sover och är omedveten och varken känner, ser eller hör ingreppet. Vanlig vaken sedering, där du är vaken och kan svara, räknas inte här. Uppgiften är informativ och påverkar inte poängen för öppenhet.
- ✗ Narkos eller djup sedering (sövd tandvård) — Ingen narkos eller djup sedering dokumenterad No general anaesthesia or intravenous/twilight sedation is documented; the anxious-patient page relies on calm handling and local anaesthesia. [s2]
Sammanfattning
Fristående mottagning på Yliopistonkatu i centrala Åbo som kombinerar allmän tandvård med estetiskt arbete, tandreglering med skenor, lasertandvård samt medicinska och estetiska injektionsbehandlingar. Fyra namngivna tandläkare och fyra tandhygienister med publicerad bakgrund, en prislista per åtgärd utan mottagnings- eller serviceavgift samt kvällstider till klockan 19 fyra dagar i veckan. Webbplatsen har fullständig schema.org Dentist-märkning med en prissatt tjänstekatalog.
Styrkor
- Öppenhet om information: 18 av 20 poäng.
- Öppenhet om priser: 15 av 15 poäng.
- Inga röda flaggor hittades i offentliga källor.
Svagheter
Ingen kategori hamnade under tröskeln för svaghet (50 % av de verifierbara poängen).
Poängfördelning
Varje kriterium nedan bedöms utifrån offentliga källor. ✓ verifierat ja · ✗ verifierat nej / hittades inte · ◐ delvis · ? ej verifierat (ger 0 poäng, inte ett negativt konstaterande).
Öppenhet om information
18 / 20
Om grundläggande fakta om mottagningen – teamet, lokalerna, behandlingarna och adressen – går att kontrollera i offentliga källor.
| ✓ | Har en fungerande webbplats Opened and read on 2026-09-07: real clinic content across services, prices, staff, contacts and patient guidance. [s1] | 4/4 |
| ✓ | Tandläkarnas namn anges Three dentists and three hygienists named on the staff page as read on 2026-09-07, each with a written self-introduction giving graduation year, university and areas of work. (The research pass wrote four and four; the page today lists three of each.) [s3] | 3/3 |
| ✓ | Tandläkarnas specialiteter anges Each dentist's graduation year and university are stated together with their areas of focus — stomatognathic physiology, aesthetic botulinum and sleep-apnoea splints for one, implant prosthetics, veneers, ceramic fillings, crowns and bridges for another. [s3] | 2/2 |
| ✓ | Egna bilder från mottagningen The lead owner photograph on the place page, read in a browser on 2026-09-08, is the practice's own waiting area — its green velvet armchairs, timber table and hand-sanitiser stand on the second floor at Yliopistonkatu 29 c. The profile is claimed and carries owner posts, so this is the clinic's own publication of its own premises and the criterion is met. [gmpb] | 2/2 |
| ✓ | Behandlingsutbudet publiceras General dentistry, hygienist care, aesthetic dentistry, aligner orthodontics, medical and aesthetic injectables, oral and maxillofacial surgery, laser dentistry, anxious-patient care and occupational dental care, each with its own page. [s2] | 3/3 |
| ✓ | Tydliga kontaktuppgifter Phone, e-mail, street address with floor and opening hours in the header of every page; consistent with the Google place record. [s1] | 2/2 |
| ✗ | Webbplats på engelska The site is Finnish only; it declares no language alternates and carries no switcher. [s1] | 0/2 |
| ✓ | Adress och karta publiceras Street address with floor published site-wide and an embedded map; the site's own structured data carries the postal address and geo-coordinates. [s1] | 2/2 |
Öppenhet om priser
15 / 15
Om du kan uppskatta vad behandlingen kostar innan du bokar. Publicerade prisintervall räknas; exakta priser krävs inte.
| ✓ | Priser eller prisintervall publiceras Standing itemised price list for dentist and hygienist treatment with the price before and after Kela reimbursement; the clinic states it charges no service or office fee. [s4] | 3/3 |
| ✓ | Pris för tandrengöring anges Hammaskivenpoisto 105 €, long 123 €, very long variant priced separately. [s4] | 2/2 |
| ✓ | Pris för lagning anges One-surface 85.50 €, two 146 €, three 180 €. [s4] | 2/2 |
| ✓ | Pris för tandkrona anges Yhdistelmämuovikruunu 210 €; the ceramic crown and veneer are quoted at consultation, which the price list states explicitly. [s4] | 2/2 |
| ✓ | Pris för implantat anges Implantti + kruunu from 1950 €. [s4] | 2/2 |
| ✓ | Pris för första besöket anges Hammastarkastus 69 € (39 € after Kela reimbursement). [s4] | 2/2 |
| ✓ | Pris för röntgen anges Intraoral 35 €, bite-wing 50 €, panoramic 98 €. [s4] | 2/2 |
Rykte och recensioner
12 / 20
Offentliga signaler från recensioner. Google-betyget justeras med en bayesiansk prior (betyg 4,0, vikt 25) så att 5,0 från en handfull recensioner inte slår 4,8 från hundratals.
| ◐ | Google-betyg (bayesianskt justerat) Read live on the place page in a browser on 2026-09-08. Unchanged from the automated reading of 2026-09-07. The star histogram — 19 five-star, 0 four-star, 0 three-star, 0 two-star and 2 one-star — sums to 21, matching the 21 in the place-page header exactly, and its weighted mean 4.619 reproduces the published 4.6. The place pin was also read for the coordinate question the open question raised: the Google place resolves to 60.4503372 / 22.2603694, which is exactly the coordinate the card carries and which sits on the Yliopistonkatu 29 c building the listing gives as its address. The 60.45033717 / 22.2577944 published in the site's own Dentist JSON-LD is about 140 m west of the building and is the outlier, so the card's geo needs no change. [gm1] [gmpb] | 3/6 |
| ◐ | Antal Google-recensioner Read live on 2026-09-08 from the place-page header, and the star histogram sums to the same figure. The card held 21 and the listing has not moved since. [gm1] [gmpb] | 1/3 |
| ✓ | Hur färska recensionerna är Newest Google review is dated 2026-09-23 (listing read 2026-09-25). [hymylle-hammaslaakaripalvelut-turku-gbp-2026-09-25] | 3/3 |
| ✗ | Mottagningen svarar på recensioner None of the 10 reviews read on Google carries an owner reply, including the 10 dated 2025-08-19 to 2026-09-23. [hymylle-hammaslaakaripalvelut-turku-deepen-5] | 0/2 |
| ✓ | Inga återkommande klagomål One critical account is visible and readable in full, a one-star a year old describing belittling and scolding treatment of a patient afraid of pain and a complete lack of understanding. It stands alone: no second negative on that or any other theme is surfaced, so the criterion is false. The one- and two-star mass is 2 of 21 = 9.5 %, and the second account is not surfaced by relevance ordering. Sample: the eight reviews Google Maps renders on the place page in its own relevance order — the "Newest" sort does not open to automation, so a review more recent than the newest one visible may exist. [gmpb] | 2/2 |
| ✓ | Inga misstänkta recensionsmönster Judged on the histogram shape, the spread of dates, the variety of reviewers and the wording, on 2026-09-08. The distribution is strictly two-valued (19 five-star, 2 one-star, nothing between), which on a base of 21 is disclosed rather than scored: the visible dates spread from eight months to two years, the accounts describe different treatments and different clinicians, and the owner engages with none of them at all — including the one-star, which a curated record would have answered. [gmpb] | 2/2 |
| ✓ | Aktiv närvaro på Facebook The clinic links its own Facebook page from its site, alongside Instagram. [fb1] | 1/1 |
| ✗ | Närvaro på TripAdvisor No TripAdvisor listing found via its search for "Hymylle Hammaslääkäripalvelut Turku" and "Hymylle Hammaslääkäripalvelut"; the clinic's site does not link to TripAdvisor (checked 2026-10-05). [hymylle-hammaslaakaripalvelut-turku-tripadvisor] [hymylle-hammaslaakaripalvelut-turku-tripadvisor-2] | 0/0.5 |
| ✗ | Andra recensionsplattformar No profile on WhatClinic or Trustpilot, and Dental Departures and Bookimed list no Finnish clinics; no Yelp page was found under its name, nor a Finnish dentist-review site with reviews of its own. [hymylle-hammaslaakaripalvelut-turku-deepen] [hymylle-hammaslaakaripalvelut-turku-deepen-2] [hymylle-hammaslaakaripalvelut-turku-deepen-3] [hymylle-hammaslaakaripalvelut-turku-deepen-4] | 0/0.5 |
Utrustning och utbud
9.5 / 15
Omfattningen av den utrustning och de behandlingar som dokumenteras offentligt. Detta mäter dokumenterad tillgång, inte behandlingskvalitet.
| ✓ | Röntgen på plats Intraoral, bite-wing and panoramic imaging priced in the clinic's own price list. [s4] | 2/2 |
| ✗ | CBCT (3D-röntgen) The price list covers intraoral, bite-wing and panoramic imaging only; no cone-beam CT is priced or described. [s4] | 0/2 |
| ✓ | Implantatbehandling Implant prosthetics named among a dentist's areas of work, and implant treatment priced. [s3] [s4] | 2/2 |
| ✓ | Tandreglering Invisalign aligner orthodontics with its own page and a published starting price of 2200 €. [s2] [s4] | 2/2 |
| ✓ | Oralkirurgi Dedicated oral and maxillofacial surgery page covering implants, soft-tissue operations and other minor oral surgery. [s5] | 2/2 |
| ✓ | Barntandvård A dentist profile states that she treats patients of all ages ('Hoidan kaikenikäisiä potilaita'). [s3] | 1.5/1.5 |
| ✗ | Akuttandvård No emergency or same-day service is named among the services; the clinic offers a dental-fear route but not an emergency one. [s2] | 0/1.5 |
| ✗ | Tar emot internationella patienter The clinic publishes nothing about foreign patients and keeps no non-Finnish version of its site. [s1] | 0/2 |
Kommunikation och service
4 / 10
Hur lätt det är att kontakta mottagningen, få svar och boka tid – särskilt för internationella patienter.
| ✗ | WhatsApp eller LINE finns Phone, e-mail and online booking only. [s1] | 0/2 |
| ? | Svarstid | 0/1.5 |
| ? | Personalen talar engelska The clinic makes no statement about the languages it works in, and there is no non-Finnish version to infer from. | 0/2.5 |
| ✓ | Förhandsbedömning är möjlig The site offers a free treatment estimate ('Pyydä maksuton hoitoarvio') as a standing call to action. [s1] | 1.5/1.5 |
| ✓ | Tydliga beskrivningar av behandlingarna Each service page explains the treatment in plain Finnish, with a background section on what it involves. [s5] | 1/1 |
| ✓ | Bekväma öppettider Confirmed on the clinic's own Google Business Profile, read in a browser on 2026-09-08: Monday to Thursday 08:00–19:00, Friday 08:00–17:00, Saturday and Sunday closed. The 19:00 close on four weekdays matches the clinic's own site exactly. [s1] [gmpb] | 1.5/1.5 |
Synlighet i AI och sökmotorer
5 / 10
Om mottagningen går att hitta när patienter söker – även via AI-assistenter. Kontrolleras med fasta sökfraser: "best dentist Finland", "English speaking dentist Finland", "dental implants Finland", "emergency dentist Finland", "Finland dental clinic for expats".
| ✗ | Nämns för: best dentist Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq1] | 0/1 |
| ✗ | Nämns för: English speaking dentist Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq2] | 0/1 |
| ✗ | Nämns för: dental implants Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq3] | 0/1 |
| ✗ | Nämns för: emergency dentist Finland The canonical city query was run in the AI-visibility pass on 2026-09-07; the clinic does not appear in the returned result list, which is held by national chains, the university, wellbeing-county pages and directories. [bsq4] | 0/1 |
| ? | Nämns för: Finland dental clinic for expats The fifth canonical query was not run for this city in the AI-visibility pass: the pass ran it only for the first research city of each country (Helsinki for Finland). Left unset rather than guessed. | 0/1 |
| ✓ | Strukturerad data på webbplatsen The site carries a full schema.org Dentist entity with PostalAddress, GeoCoordinates, opening hours and an OfferCatalog of priced MedicalProcedure offers — the strongest markup of the four Turku clinics researched. [s1] | 1.5/1.5 |
| ✓ | Kvalitet på Google-indexeringen The clinic's own domain holds the first result for its own name and five of the first thirteen (front page, services, contacts, price list, staff); the rest are its Facebook page, directories and a LinkedIn profile of its chief dentist. [giq1] | 2/2 |
| ✓ | Egna sidor för varje behandling Individual pages per treatment across nine service groups. [s2] | 1.5/1.5 |
Rankningens ledande kliniker i AI-svar
Sökningarna ovan är indexets egen kontroll. De tre ledande klinikerna har dessutom en fullständig mätning: hur ofta ChatGPT och Gemini nämner dem när en patient ber om en rekommendation av en tandläkare.
- #1Hammaslääkäriasema Dent Å14.9 av 100Visa rapporten → rapport på engelska
- #2Hammasvahti47.6 av 100Visa rapporten → rapport på engelska
- #3Hammaslääkäriasema Helmiäinen52.3 av 100Visa rapporten → rapport på engelska
Mätt av Ansmeter, 2026-10-08. Ansmeter är en närstående tjänst. Dess siffra ingår inte i den här rankningen och påverkar inte placeringarna – poängen ändras bara när offentliga uppgifter ändras.
Tillstånd och legitimationer
Om mottagningen publicerar sitt tillstånd eller sin registrering som vårdgivare och de tandläkare som arbetar där, tillsammans med deras legitimationsnummer. Ett verifierat ”publiceras inte” registreras som en röd flagga; uppgifter som vi ännu inte kontrollerat visas som ej verifierade och ger inget avdrag.
Mottagningens tillstånd eller registrering: ännu inte kontrollerat mot offentliga källor – ej verifierat, inget avdrag
Tandläkare och legitimationer
| Tandläkare | Specialitet | Legitimationsnr |
|---|---|---|
| Emma Ylitalo [s3] | Hammaslääkäri, chief dentist; graduated University of Turku 2010, seven years in the public sector before private practice | ej verifierat |
| Saija Vahe [s3] | Hammaslääkäri; graduated University of Turku 1998; implant prosthetics, veneers, ceramic fillings, crowns, bridges and removable prosthetics | ej verifierat |
| Anna Wickström [s3] | Hammaslääkäri; graduated University of Eastern Finland 2023; general dentistry, public and private sector experience | ej verifierat |
Tandläkarna namnges; deras legitimationsnummer har ännu inte kontrollerats mot offentliga källor – ej verifierat, inget avdrag.
Röda flaggor
Inga röda flaggor hittades i de offentliga källor vi granskat.
Uppgifter vi inte kunnat verifiera
- Kommunikation och service: Svarstid
- Kommunikation och service: Personalen talar engelska
- Synlighet i AI och sökmotorer: Nämns för: Finland dental clinic for expats
Ej verifierade uppgifter ger 0 poäng men behandlas inte som negativa konstateranden. Om du kan styrka någon av dem, skicka gärna en rättelse.
Kontaktuppgifter
| Webbplats | https://hymylle.fi/ |
|---|---|
| Telefon | +358 10 212 1680 |
| https://www.facebook.com/hymylle/ | |
| Google Maps | Visa på kartan |
| Adress | Yliopistonkatu 29 c B, 2nd floor, 20100 Turku, Finland |
Kontaktuppgifterna anges endast för identifiering och kan ändras. Kontrollera dem direkt med mottagningen.
Källor
| Nr | Källa | Vad den styrker | Hämtad |
|---|---|---|---|
| s1 | https://hymylle.fi/ | Clinic's own front page: hours, address, contacts, free treatment estimate | 2026-09-07 |
| s2 | https://hymylle.fi/palvelut-turku | Clinic's own service index | 2026-09-07 |
| s3 | https://hymylle.fi/henkilokunta | Own site roster page names this dentist (read 2026-09-10): "tiikka, laminaatit, keraamiset täytteet, kruunut, sillat ja irtoproteesit) Anna Wickström Hammaslääkäri Olen valmistunut hammaslääkäriksi Itä-Suomen yliopistosta vuonna" | 2026-09-10 |
| s4 | https://hymylle.fi/hinnasto | Clinic's own standing price list | 2026-09-07 |
| s5 | https://hymylle.fi/hammaskirurgia-turku | Clinic's own oral and maxillofacial surgery page | 2026-09-07 |
| gm1 | https://www.google.com/maps/place/?q=place_id:ChIJESAMUHJ3jEYRCZi-A… | Live Google Maps place record: name, category Dentist, address, website, rating, coordinates | 2026-09-07 |
| fb1 | https://www.facebook.com/hymylle/ | Clinic's own Facebook page, linked from its site | 2026-09-07 |
| giq1 | search:"Hymylle Hammaslääkäripalvelut" Turku | Name-and-city search used to judge how well the clinic's own pages rank for its own name (web search) | 2026-09-07 |
| bsq1 | search:best dentist Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| bsq2 | search:English speaking dentist Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| bsq3 | search:dental implants Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| bsq4 | search:emergency dentist Turku | Canonical visibility query, AI-visibility pass (web search) | 2026-09-07 |
| gmpb | https://www.google.com/maps/place/x/@60.4503372,22.2603694,17z/data… | The clinic’s Google Maps place page, opened in a real browser on 2026-09-08. The Reviews tab (this URL) gives the headline rating, the review-count header, the five star-histogram buckets read whole from their accessibility labels, and the eight most-relevant reviews with their star values, dates, text and owner replies; the sibling Overview URL https://www.google.com/maps/place/x/@60.4503372,22.2603694,17z/data=!4m5!3m4!1s0x468c7772500c2011:0x3c85adca03be9809!8m2!3d60.4503372!4d22.2603694?hl=en gives the listing name, address, telephone, website, business category, the full published opening week and the lead owner photograph. The listing opens as «Hymylle Hammaslääkäripalvelut Oy», category Dentist, at Yliopistonkatu 29 c B23-24, 2. kerros, 20100 Turku · +358 10 212 1680 · hymylle.fi — the identifiers the card itself carries, so the place identifier resolves to this practice and not to a neighbour. | 2026-09-08 |
| hymylle-hammaslaakaripalvelut-turku-gbp-2026-09-25 | https://www.google.com/maps?cid=4361082897336014857&hl=en | Google listing read on 2026-09-25: rating 4.6 from 22 reviews; star histogram 1★ 2 / 2★ 0 / 3★ 0 / 4★ 1 / 5★ 19; newest review dated 2026-09-23. | 2026-09-25 |
| hymylle-hammaslaakaripalvelut-turku-deepen | https://www.whatclinic.com/dentists/finland | WhatClinic read 2026-10-02: the Turku catalogue (no Turku page; none listed) and WhatClinic's Finland sitemap (8 Finnish profiles) list no profile for the clinic; direct addresses /dentists/finland/hymylle-hammaslaeaekaeripalvelut, /dentists/finland/hymylle return 404. | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-2 | https://www.trustpilot.com/review/hymylle.fi | Trustpilot read 2026-10-02: no page for hymylle.fi ("Whoops! The page you're looking for could not be found"). | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-3 | https://www.dentaldepartures.com/dentists/finland | Dental Departures read 2026-10-02: has no Finland location (its Finland page returns "not found" and its clinic search recognises neither Finland nor Turku); no profile for this clinic. | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-4 | https://us-uk.bookimed.com/sitemap-us-uk-clinics-country.xml | Bookimed read 2026-10-02: Finland is not among its 53 clinic countries (no Finland page), and none of its 2,127 clinic pages is in Finland. | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-deepen-5 | https://www.google.com/maps?cid=4361082897336014857&hl=en | Google listing "Hymylle Hammaslääkäripalvelut Oy" (Dentist), read 2026-10-02 in three review orders (newest, lowest-rated, most relevant first): 4.6 from 22 reviews (1★ 2 / 2★ 0 / 3★ 0 / 4★ 1 / 5★ 19); 10 distinct reviews read, dated 2025-08-19 to 2026-09-23 | 2026-10-02 |
| hymylle-hammaslaakaripalvelut-turku-tripadvisor | https://www.tripadvisor.com/TypeAheadJson?action=API&details=true&q… | TripAdvisor's own search, read 2026-10-05: 12 suggestions for "Hymylle Hammaslääkäripalvelut Turku" (1 place, 4 attractions, 6 hotels, 1 restaurant), none of them a dental practice in or near Turku; no suggestions for "Hymylle Hammaslääkäripalvelut"; no listing for this clinic | 2026-10-05 |
| hymylle-hammaslaakaripalvelut-turku-tripadvisor-2 | https://hymylle.fi/ | Clinic's website, home page read 2026-10-05: no link to a TripAdvisor page | 2026-10-05 |
Ändringshistorik
| Datum | Ändring |
|---|---|
| 2026-10-05 | TripAdvisor presence checked on 2026-10-05: no listing found for this clinic. |
| 2026-10-02 | Read 10 of the clinic's Google reviews on 2026-10-02: no owner replies seen. |
| 2026-10-02 | Presence on review platforms checked on 2026-10-02: no profile on WhatClinic or Trustpilot; Dental Departures and Bookimed do not cover Finland. |
| 2026-09-29 | Corrected 2026-09-29: clinic responds to reviews now unverified: only 8 reviews were checked for owner replies; review recency within 3 months (newest review dated 2026-09-23). |
| 2026-09-10 | Name-verification pass 2026-09-10: 2 doctor(s) previously no-match against the own-site roster confirmed by re-reading the clinic's staff/team page(s) (Saija Vahe; Anna Wickström); no data other than sources/license-passthrough changed. |
| 2026-09-08 | Checked by hand in a browser: the clinic’s Google Maps place page was opened in a real browser and read on both its Reviews and Overview tabs. Recorded from it: the rating re-verified against the star histogram, the review count, the histogram itself (19/0/0/0/2 = 21, weighted mean 4.619), review recency, the owner-reply state, the complaint reading and the manipulation reading from the eight most-relevant reviews, the lead owner photograph and the full published opening week. Fields this pass did not measure are untouched. |
| 2026-09-07 | Initial data collection: clinic website read across the front page, service index, staff page, price list, surgery page and service-voucher page; Google Maps place record read live. Review-side fields and both licence layers left unset with reasons and queued for a manual browser check. |
En fråga eller en rättelse?
Har du en fråga, ett förslag eller en rättelse till den här sidan? Hör av dig – vi läser alla meddelanden. Rättelser av uppgifter kontrolleras mot källor och genomförs med en offentlig post i ändringshistoriken.